Dosage Gene Finder

Advanced tandem gene duplication analysis platform

Analysis Configuration

Required Files

Protein Sequences *

Protein Sequences (FASTA)

Standard FASTA format with protein sequences.
Example:

													>gene001

													LFSSSDYAILIGRNAKRMMTYLSIPADDALQSTLSFFEKMEARYGGVSMLG
													SPQLLLRKPDQFMQNVLFFREMGVDKKTTGKILCRSPEIFASNVDNTLKKK
												

Select File Change Remove

Supported: .fasta

Gene Coordinates *

Gene Coordinates (TSV)

Tab-separated file with 5 columns: Gene ID • Chromosome • Start • End • Strand
Example:

													gene ID	chromosome	start	end	strand

													Zm00001eb000010_T001	chr1	34617	40204	+

													Zm00001eb000020_T001	chr1	41214	46762	-

Select File Change Remove

Supported: .txt

Analysis Parameters

Species Abbreviation

Non-Ortholog Numbers

Repeated Copy Threshold

Coverage Threshold

Identity Threshold

E-value Threshold

Email Notification (Optional)

What are Tandem Duplications?

Adjacent gene copies arising through molecular mechanisms like unequal crossing over and replication slippage.

Key Features

BLAST-based detection algorithms
Customizable similarity thresholds
Chromosome visualization plots
Multiple output formats

Applications

🔬 Comparative Genomics

🧬 Evolutionary Studies

🌱 Plant Breeding

💊 Medical Research

Uploading Files...

Upload Progress: {[ uploadProgress ]}%

Task Submitted Successfully, Processing in Background...

Task ID: {[ task_id ]}

Estimated processing time: 5-15 minutes, please wait patiently

The system is analyzing your data and will automatically display download links when completed